SCOPe 2.04: Domain d3p83d_: 3p83 D:

Lineage for d3p83d_ (3p83 D:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (26 species)
   not a true protein

7. Species Archaeoglobus fulgidus [TaxId:2234] [256016] (1 PDB entry)

8. Domain d3p83d_: 3p83 D: [248436]
   Other proteins in same PDB: d3p83a1, d3p83a2, d3p83b1, d3p83b2, d3p83c1, d3p83c2
   automated match to d2dffa_
   protein/DNA complex; protein/RNA complex

Details for d3p83d_

PDB Entry: 3p83, 3.05 Å

PDB Description: Structure of the PCNA:RNase HII complex from Archaeoglobus fulgidus.

PDB Compounds: (D:) ribonuclease hii

SCOPe Domain Sequences for d3p83d_:

Sequence; same for both SEQRES and ATOM records:

>d3p83d_ c.55.3.0 (D:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
spefpgrlmkagideagkgcvigplvvagvacsdedrlrklgvkdskklsqgrreelaee
irkicrtevlkvspenldermaaktineilkecyaeiilrlkpeiayvdspdviperlsr
eleeitglrvvaehkadekyplvaaasiiakverereierlkekfgdfgsgyasdprtre
vlkewiasgripscvrmrwktvsnlrqktlddf

Timeline for d3p83d_:

• d3p83d_ is new in SCOPe 2.04-stable
  
• d3p83d_ appears in SCOPe 2.05
  
• d3p83d_ appears in the current release, SCOPe 2.08, called d3p83d1