SCOPe 2.04: Domain d3ozya1: 3ozy A:2-132

Lineage for d3ozya1 (3ozy A:2-132)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (67 species)
   not a true protein

7. Species Bordetella bronchiseptica [TaxId:518] [256002] (3 PDB entries)

8. Domain d3ozya1: 3ozy A:2-132 [248394]
   Other proteins in same PDB: d3ozya2, d3ozyb2
   automated match to d3sjna1
   complexed with acy, dxl, gol, mg

Details for d3ozya1

PDB Entry: 3ozy, 1.3 Å

PDB Description: Crystal structure of enolase superfamily member from Bordetella bronchiseptica complexed with Mg and m-Xylarate

PDB Compounds: (A:) Putative mandelate racemase

SCOPe Domain Sequences for d3ozya1:

Sequence; same for both SEQRES and ATOM records:

>d3ozya1 d.54.1.0 (A:2-132) automated matches {Bordetella bronchiseptica [TaxId: 518]}
slkitevkahalstpipermrvesgaglklnrqmilvevrtdegvtgvgspsgpydlavl
kraiedvigpqligedpaninylwhkvfhgevsrnlghrsvgiaamsgvdialwdlkgra
mnqpiyqllgg

Timeline for d3ozya1:

• d3ozya1 is new in SCOPe 2.04-stable
  
• d3ozya1 appears in SCOPe 2.05
  
• d3ozya1 appears in the current release, SCOPe 2.08