SCOPe 2.06: Domain d3ozvb3: 3ozv B:262-403

Lineage for d3ozvb3 (3ozv B:262-403)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families)
   binds NADP differently than classical Rossmann-fold
   N-terminal FAD-linked domain contains (6,10) barrel

5. Family c.25.1.0: automated matches [227163] (1 protein)
   not a true family

6. Protein automated matches [226871] (18 species)
   not a true protein

7. Species Ralstonia eutropha [TaxId:381666] [256011] (3 PDB entries)

8. Domain d3ozvb3: 3ozv B:262-403 [248387]
   Other proteins in same PDB: d3ozva1, d3ozva2, d3ozvb1, d3ozvb2
   automated match to d1cqxa3
   complexed with dgg, ecn, fad, hem, po4

Details for d3ozvb3

PDB Entry: 3ozv, 2.4 Å

PDB Description: The Crystal Structure of flavohemoglobin from R. eutrophus in complex with econazole

PDB Compounds: (B:) Flavohemoglobin

SCOPe Domain Sequences for d3ozvb3:

Sequence; same for both SEQRES and ATOM records:

>d3ozvb3 c.25.1.0 (B:262-403) automated matches {Ralstonia eutropha [TaxId: 381666]}
dvdaktpivlisggvgltpmvsmlkvalqapprqvvfvhgarnsavhamrdrlreaakty
enldlfvfydqplpedvqgrdydypglvdvkqieksillpdadyyicgpipfmrmqhdal
knlgihearihyevfgpdlfae

Timeline for d3ozvb3:

• d3ozvb3 first appeared in SCOPe 2.04
  
• d3ozvb3 appears in SCOPe 2.05
  
• d3ozvb3 appears in SCOPe 2.07
  
• d3ozvb3 appears in the current release, SCOPe 2.08