SCOPe 2.06: Domain d3ozva1: 3ozv A:1-150

Lineage for d3ozva1 (3ozv A:1-150)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.0: automated matches [191420] (1 protein)
   not a true family

6. Protein automated matches [190590] (21 species)
   not a true protein

7. Species Ralstonia eutropha [TaxId:381666] [256009] (3 PDB entries)

8. Domain d3ozva1: 3ozv A:1-150 [248382]
   Other proteins in same PDB: d3ozva2, d3ozva3, d3ozvb2, d3ozvb3
   automated match to d1cqxa1
   complexed with dgg, ecn, fad, hem, po4

Details for d3ozva1

PDB Entry: 3ozv, 2.4 Å

PDB Description: The Crystal Structure of flavohemoglobin from R. eutrophus in complex with econazole

PDB Compounds: (A:) Flavohemoglobin

SCOPe Domain Sequences for d3ozva1:

Sequence; same for both SEQRES and ATOM records:

>d3ozva1 a.1.1.0 (A:1-150) automated matches {Ralstonia eutropha [TaxId: 381666]}
mltqktkdivkatapvlaehgydiikcfyqrmfeahpelknvfnmahqeqgqqqqalara
vyayaeniedpnslmavlkniankhaslgvkpeqypivgehllaaikevlgnaatddiis
awaqaygnladvlmgmeselyersaeqpgg

Timeline for d3ozva1:

• d3ozva1 first appeared in SCOPe 2.04
  
• d3ozva1 appears in SCOPe 2.05
  
• d3ozva1 appears in SCOPe 2.07
  
• d3ozva1 appears in the current release, SCOPe 2.08