Lineage for d1snp__ (1snp -)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.40: OB-fold [50198] (7 superfamilies) 
Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family) 
Family b.40.1.1: Staphylococcal nuclease [50200] (1 protein) Protein Staphylococcal nuclease [50201] (1 species) Species Staphylococcus aureus [TaxId:1280] [50202] (52 PDB entries) 
Domain d1snp__: 1snp - [24838]
Details for d1snp__
PDB Entry: 1snp (more details), 1.95 Å
PDB Description: protein stability in staphylococcal nuclease
SCOP Domain Sequences for d1snp__:
Sequence, based on SEQRES records: (download)
>d1snp__ b.40.1.1 (-) Staphylococcal nuclease {Staphylococcus aureus}
klhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkkm
venakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqll
rkseaqakkeklniws
Sequence, based on observed residues (ATOM records): (download)
>d1snp__ b.40.1.1 (-) Staphylococcal nuclease {Staphylococcus aureus}
klhkepatlikaidgdtvklmykgqpmtfrlllvdtpetvekygpeasaftkkmvenakk
ievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqllrkseaq
akkeklniws
SCOP Domain Coordinates for d1snp__:
Click to download the PDB-style file with coordinates for d1snp__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1snp__:
- d1snp__ appears in SCOP 1.57
- d1snp__ appears in the current release, SCOPe 2.08, called d1snpa_
View in 3D