Lineage for d3ozmh1 (3ozm H:2-132)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1649013Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1649014Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1649263Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1649264Protein automated matches [226922] (67 species)
    not a true protein
  7. 1649352Species Bordetella bronchiseptica [TaxId:518] [256002] (3 PDB entries)
  8. 1649362Domain d3ozmh1: 3ozm H:2-132 [248377]
    Other proteins in same PDB: d3ozma2, d3ozmb2, d3ozmc2, d3ozmd2, d3ozme2, d3ozmf2, d3ozmg2, d3ozmh2
    automated match to d3sjna1
    complexed with dxl, gol, ly9, mg

Details for d3ozmh1

PDB Entry: 3ozm (more details), 1.6 Å

PDB Description: Crystal structure of enolase superfamily member from Bordetella bronchiseptica complexed with Mg, m-Xylarate and L-Lyxarate
PDB Compounds: (H:) Putative mandelate racemase

SCOPe Domain Sequences for d3ozmh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ozmh1 d.54.1.0 (H:2-132) automated matches {Bordetella bronchiseptica [TaxId: 518]}
slkitevkahalstpipermrvesgaglklnrqmilvevrtdegvtgvgspsgpydlavl
kraiedvigpqligedpaninylwhkvfhgevsrnlghrsvgiaamsgvdialwdlkgra
mnqpiyqllgg

SCOPe Domain Coordinates for d3ozmh1:

Click to download the PDB-style file with coordinates for d3ozmh1.
(The format of our PDB-style files is described here.)

Timeline for d3ozmh1: