![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
![]() | Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
![]() | Protein automated matches [226923] (79 species) not a true protein |
![]() | Species Bordetella bronchiseptica [TaxId:518] [256003] (4 PDB entries) |
![]() | Domain d3ozmd2: 3ozm D:133-382 [248370] Other proteins in same PDB: d3ozma1, d3ozma3, d3ozmb1, d3ozmb3, d3ozmc1, d3ozmc3, d3ozmd1, d3ozmd3, d3ozme1, d3ozme3, d3ozmf1, d3ozmf3, d3ozmg1, d3ozmg3, d3ozmh1, d3ozmh3 automated match to d3sjna2 complexed with dxl, gol, ly9, mg |
PDB Entry: 3ozm (more details), 1.6 Å
SCOPe Domain Sequences for d3ozmd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ozmd2 c.1.11.0 (D:133-382) automated matches {Bordetella bronchiseptica [TaxId: 518]} kfhtrgvrayassiywdltpdqaadelagwveqgftaaklkvgraprkdaanlramrqrv gadveilvdanqslgrhdalamlrildeagcywfeeplsiddieghrilraqgtpvriat genlytrnafndyirndaidvlqadasraggitealaisasaasahlawnphtfndiitv aanlhlvaasphpamfewdithndlmtrlasydlklenglvqppqgpglgfeidwdfvaa hawkgepaig
Timeline for d3ozmd2: