Lineage for d3ozmc2 (3ozm C:133-387)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1573508Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 1573839Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 1573840Protein automated matches [226923] (59 species)
    not a true protein
  7. 1573909Species Bordetella bronchiseptica [TaxId:518] [256003] (3 PDB entries)
  8. 1573914Domain d3ozmc2: 3ozm C:133-387 [248368]
    Other proteins in same PDB: d3ozma1, d3ozmb1, d3ozmc1, d3ozmd1, d3ozme1, d3ozmf1, d3ozmg1, d3ozmh1
    automated match to d3sjna2
    complexed with dxl, gol, ly9, mg

Details for d3ozmc2

PDB Entry: 3ozm (more details), 1.6 Å

PDB Description: Crystal structure of enolase superfamily member from Bordetella bronchiseptica complexed with Mg, m-Xylarate and L-Lyxarate
PDB Compounds: (C:) Putative mandelate racemase

SCOPe Domain Sequences for d3ozmc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ozmc2 c.1.11.0 (C:133-387) automated matches {Bordetella bronchiseptica [TaxId: 518]}
kfhtrgvrayassiywdltpdqaadelagwveqgftaaklkvgraprkdaanlramrqrv
gadveilvdanqslgrhdalamlrildeagcywfeeplsiddieghrilraqgtpvriat
genlytrnafndyirndaidvlqadasraggitealaisasaasahlawnphtfndiitv
aanlhlvaasphpamfewdithndlmtrlasydlklenglvqppqgpglgfeidwdfvaa
hawkgepaigaghgm

SCOPe Domain Coordinates for d3ozmc2:

Click to download the PDB-style file with coordinates for d3ozmc2.
(The format of our PDB-style files is described here.)

Timeline for d3ozmc2: