Lineage for d3ozma1 (3ozm A:4-132)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2947989Species Bordetella bronchiseptica [TaxId:518] [256002] (4 PDB entries)
  8. 2947992Domain d3ozma1: 3ozm A:4-132 [248363]
    Other proteins in same PDB: d3ozma2, d3ozma3, d3ozmb2, d3ozmb3, d3ozmc2, d3ozmc3, d3ozmd2, d3ozmd3, d3ozme2, d3ozme3, d3ozmf2, d3ozmf3, d3ozmg2, d3ozmg3, d3ozmh2, d3ozmh3
    automated match to d3sjna1
    complexed with dxl, gol, ly9, mg

Details for d3ozma1

PDB Entry: 3ozm (more details), 1.6 Å

PDB Description: Crystal structure of enolase superfamily member from Bordetella bronchiseptica complexed with Mg, m-Xylarate and L-Lyxarate
PDB Compounds: (A:) Putative mandelate racemase

SCOPe Domain Sequences for d3ozma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ozma1 d.54.1.0 (A:4-132) automated matches {Bordetella bronchiseptica [TaxId: 518]}
kitevkahalstpipermrvesgaglklnrqmilvevrtdegvtgvgspsgpydlavlkr
aiedvigpqligedpaninylwhkvfhgevsrnlghrsvgiaamsgvdialwdlkgramn
qpiyqllgg

SCOPe Domain Coordinates for d3ozma1:

Click to download the PDB-style file with coordinates for d3ozma1.
(The format of our PDB-style files is described here.)

Timeline for d3ozma1: