Lineage for d3ouzb2 (3ouz B:117-329)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2217268Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2217269Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2217671Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 2217672Protein automated matches [226904] (32 species)
    not a true protein
  7. 2217707Species Campylobacter jejuni [TaxId:192222] [256007] (2 PDB entries)
  8. 2217709Domain d3ouzb2: 3ouz B:117-329 [248350]
    Other proteins in same PDB: d3ouza1, d3ouza3, d3ouza4, d3ouzb1, d3ouzb3
    automated match to d1ulza3
    complexed with adp, fmt, gol, mg, mlt, srt, tla

Details for d3ouzb2

PDB Entry: 3ouz (more details), 1.9 Å

PDB Description: crystal structure of biotin carboxylase-adp complex from campylobacter jejuni
PDB Compounds: (B:) biotin carboxylase

SCOPe Domain Sequences for d3ouzb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ouzb2 d.142.1.0 (B:117-329) automated matches {Campylobacter jejuni [TaxId: 192222]}
kskakqvmqragvpvipgsdgalagaeaakklakeigypvilkaaaggggrgmrvvenek
dlekaywsaeseamtafgdgtmymekyiqnprhievqvigdsfgnvihvgerdcsmqrrh
qklieespailldektrtrlhetaikaakaigyegagtfeflvdknldfyfiemntrlqv
ehcvsemvsgidiieqmikvaegyalpsqesik

SCOPe Domain Coordinates for d3ouzb2:

Click to download the PDB-style file with coordinates for d3ouzb2.
(The format of our PDB-style files is described here.)

Timeline for d3ouzb2: