SCOPe 2.05: Domain d3ouzb1: 3ouz B:1-116

Lineage for d3ouzb1 (3ouz B:1-116)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (9 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.0: automated matches [227183] (1 protein)
   not a true family

6. Protein automated matches [226903] (28 species)
   not a true protein

7. Species Campylobacter jejuni [TaxId:192222] [256006] (2 PDB entries)

8. Domain d3ouzb1: 3ouz B:1-116 [248349]
   Other proteins in same PDB: d3ouza2, d3ouza3, d3ouzb2, d3ouzb3
   automated match to d1ulza2
   complexed with adp, fmt, gol, mg, mlt, srt, tla

Details for d3ouzb1

PDB Entry: 3ouz, 1.9 Å

PDB Description: crystal structure of biotin carboxylase-adp complex from campylobacter jejuni

PDB Compounds: (B:) biotin carboxylase

SCOPe Domain Sequences for d3ouzb1:

Sequence; same for both SEQRES and ATOM records:

>d3ouzb1 c.30.1.0 (B:1-116) automated matches {Campylobacter jejuni [TaxId: 192222]}
meiksilianrgeialralrtikemgkkaicvyseadkdalylkyadasicigkarsses
ylnipaiiaaaeiaeadaifpgygflsenqnfveicakhnikfigpsveamnlmsd

Timeline for d3ouzb1:

• d3ouzb1 first appeared in SCOPe 2.04
  
• d3ouzb1 appears in SCOPe 2.06
  
• d3ouzb1 appears in the current release, SCOPe 2.08