Lineage for d3ouza3 (3ouz A:330-443)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2082731Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2082834Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) (S)
  5. 2082959Family b.84.2.0: automated matches [254217] (1 protein)
    not a true family
  6. 2082960Protein automated matches [254496] (13 species)
    not a true protein
  7. 2082966Species Campylobacter jejuni [TaxId:192222] [256008] (2 PDB entries)
  8. 2082967Domain d3ouza3: 3ouz A:330-443 [248348]
    Other proteins in same PDB: d3ouza1, d3ouza2, d3ouza4, d3ouzb1, d3ouzb2
    automated match to d1ulza1
    complexed with adp, fmt, gol, mg, mlt, srt, tla

Details for d3ouza3

PDB Entry: 3ouz (more details), 1.9 Å

PDB Description: crystal structure of biotin carboxylase-adp complex from campylobacter jejuni
PDB Compounds: (A:) biotin carboxylase

SCOPe Domain Sequences for d3ouza3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ouza3 b.84.2.0 (A:330-443) automated matches {Campylobacter jejuni [TaxId: 192222]}
lnghsiecritaedsktflpspgkitkyippagrnvrmeshcyqdysvpayydsmigklv
vwaedrnkaiakmkvaldellisgikttkdfhlsmmenpdfinnnydtnylarh

SCOPe Domain Coordinates for d3ouza3:

Click to download the PDB-style file with coordinates for d3ouza3.
(The format of our PDB-style files is described here.)

Timeline for d3ouza3: