Lineage for d3op2a2 (3op2 A:133-381)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2836768Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2837252Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2837253Protein automated matches [226923] (79 species)
    not a true protein
  7. 2837322Species Bordetella bronchiseptica [TaxId:518] [256003] (4 PDB entries)
  8. 2837335Domain d3op2a2: 3op2 A:133-381 [248319]
    Other proteins in same PDB: d3op2a1, d3op2a3, d3op2b1, d3op2b3
    automated match to d3sjna2
    complexed with akg, mg, po4

Details for d3op2a2

PDB Entry: 3op2 (more details), 2 Å

PDB Description: crystal structure of putative mandelate racemase from bordetella bronchiseptica rb50 complexed with 2-oxoglutarate/phosphate
PDB Compounds: (A:) Putative mandelate racemase

SCOPe Domain Sequences for d3op2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3op2a2 c.1.11.0 (A:133-381) automated matches {Bordetella bronchiseptica [TaxId: 518]}
kfhtrgvrayassiywdltpdqaadelagwveqgftaaklkvgraprkdaanlramrqrv
gadveilvdanqslgrhdalamlrildeagcywfeeplsiddieghrilraqgtpvriat
genlytrnafndyirndaidvlqadasraggitealaisasaasahlawnphtfndiitv
aanlhlvaasphpamfewdithndlmtrlasydlklenglvqppqgpglgfeidwdfvaa
hawkgepai

SCOPe Domain Coordinates for d3op2a2:

Click to download the PDB-style file with coordinates for d3op2a2.
(The format of our PDB-style files is described here.)

Timeline for d3op2a2: