SCOPe 2.04: Domain d3op2a1: 3op2 A:2-132

Lineage for d3op2a1 (3op2 A:2-132)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (67 species)
   not a true protein

7. Species Bordetella bronchiseptica [TaxId:518] [256002] (3 PDB entries)

8. Domain d3op2a1: 3op2 A:2-132 [248318]
   Other proteins in same PDB: d3op2a2, d3op2b2
   automated match to d3sjna1
   complexed with akg, mg, po4

Details for d3op2a1

PDB Entry: 3op2, 2 Å

PDB Description: crystal structure of putative mandelate racemase from bordetella bronchiseptica rb50 complexed with 2-oxoglutarate/phosphate

PDB Compounds: (A:) Putative mandelate racemase

SCOPe Domain Sequences for d3op2a1:

Sequence, based on SEQRES records:

>d3op2a1 d.54.1.0 (A:2-132) automated matches {Bordetella bronchiseptica [TaxId: 518]}
slkitevkahalstpipermrvesgaglklnrqmilvevrtdegvtgvgspsgpydlavl
kraiedvigpqligedpaninylwhkvfhgevsrnlghrsvgiaamsgvdialwdlkgra
mnqpiyqllgg

Sequence, based on observed residues (ATOM records):

>d3op2a1 d.54.1.0 (A:2-132) automated matches {Bordetella bronchiseptica [TaxId: 518]}
slkitevkahalstpipermrvesgaglklnrqmilvevrtdegvtgvgspsgpydlavl
kraiedvigpqligedpaninylwhkvfhgevsrsvgiaamsgvdialwdlkgramnqpi
yqllgg

Timeline for d3op2a1:

• d3op2a1 is new in SCOPe 2.04-stable
  
• d3op2a1 appears in SCOPe 2.05
  
• d3op2a1 appears in the current release, SCOPe 2.08