SCOPe 2.04: Domain d3omza2: 3omz A:139-250

Lineage for d3omza2 (3omz A:139-250)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)

8. Domain d3omza2: 3omz A:139-250 [248314]
   automated match to d4mayc1

Details for d3omza2

PDB Entry: 3omz, 3.04 Å

PDB Description: Crystal structure of MICA-specific human gamma delta T cell receptor

PDB Compounds: (A:) human Vdelta1 gamma delta T cell receptor delta1A/B-3

SCOPe Domain Sequences for d3omza2:

Sequence; same for both SEQRES and ATOM records:

>d3omza2 b.1.1.0 (A:139-250) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vtqaqssvsmpvrkavtlnclyetswwsyyifwykrlpskemiflirqgsdeqnaksgry
svnfkkaaksvaltisalqledsakyfcalgesltradklifgkgtrvtvep

Timeline for d3omza2:

• d3omza2 is new in SCOPe 2.04-stable
  
• d3omza2 appears in SCOPe 2.05
  
• d3omza2 appears in the current release, SCOPe 2.08