Lineage for d3ojwa1 (3ojw A:66-239)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1838447Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 1838906Family c.23.5.0: automated matches [191330] (1 protein)
    not a true family
  6. 1838907Protein automated matches [190158] (18 species)
    not a true protein
  7. 1838988Species Norway rat (Rattus norvegicus) [TaxId:10116] [255999] (2 PDB entries)
  8. 1838989Domain d3ojwa1: 3ojw A:66-239 [248307]
    Other proteins in same PDB: d3ojwa2, d3ojwa3
    automated match to d1ja1a2
    complexed with fad, fmn

Details for d3ojwa1

PDB Entry: 3ojw (more details), 2.2 Å

PDB Description: disulfide crosslinked cytochrome p450 reductase inactive
PDB Compounds: (A:) nadph-cytochrome p450 reductase

SCOPe Domain Sequences for d3ojwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ojwa1 c.23.5.0 (A:66-239) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
essfvekmkktgrniivfygsqtgtaeefanrlskdahrygmrgmsadpeeydladlssl
peidkslvvfamatygegdptcnaqdfydwlqetdvdltgvkfavfglgnktyehfnamg
kyvdqrleqlgaqrifelglgdddgnleedfitwreqfwpavaeffgveatgee

SCOPe Domain Coordinates for d3ojwa1:

Click to download the PDB-style file with coordinates for d3ojwa1.
(The format of our PDB-style files is described here.)

Timeline for d3ojwa1: