Class a: All alpha proteins [46456] (290 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
Protein automated matches [190036] (60 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:419947] [255998] (2 PDB entries) |
Domain d3oj5e_: 3oj5 E: [248282] automated match to d1z4aa_ |
PDB Entry: 3oj5 (more details), 2.85 Å
SCOPe Domain Sequences for d3oj5e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3oj5e_ a.25.1.0 (E:) automated matches {Mycobacterium tuberculosis [TaxId: 419947]} ktkfhalmqeqihneftaaqqyvaiavyfdsedlpqlakhfysqaveernhammlvqhll drdlrveipgvdtvrnqfdrprealalaldqertvtdqvgrltavardegdflgeqfmqw flqeqieevalmatlvrvadraganlfelenfvarev
Timeline for d3oj5e_: