SCOPe 2.08: Domain d3ogva3: 3ogv A:572-668

Lineage for d3ogva3 (3ogv A:572-668)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.149: Beta-galactosidase LacA, domain 3 [117099] (1 superfamily)
   sandwich; 8 strands in 2 sheets

4. Superfamily b.149.1: Beta-galactosidase LacA, domain 3 [117100] (2 families)
   automatically mapped to Pfam PF13363

5. Family b.149.1.0: automated matches [254310] (1 protein)
   not a true family

6. Protein automated matches [254712] (3 species)
   not a true protein

7. Species Trichoderma reesei [TaxId:51453] [255995] (4 PDB entries)

8. Domain d3ogva3: 3ogv A:572-668 [248267]
   Other proteins in same PDB: d3ogva1, d3ogva2, d3ogva4, d3ogva5
   automated match to d1tg7a1
   complexed with nag, ptq

Details for d3ogva3

PDB Entry: 3ogv, 1.4 Å

PDB Description: complex structure of beta-galactosidase from trichoderma reesei with petg

PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d3ogva3:

Sequence; same for both SEQRES and ATOM records:

>d3ogva3 b.149.1.0 (A:572-668) automated matches {Trichoderma reesei [TaxId: 51453]}
rnsaynywvptlpgsgkqsaygsslmnpdsviinggylirsvaikgnalsvqadfnvttp
leiigipkgisklavngkelgysvselgdwiahpaie

Timeline for d3ogva3:

• d3ogva3 first appeared in SCOPe 2.04
  
• d3ogva3 appears in SCOPe 2.07