Lineage for d3ogva2 (3ogv A:394-571)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2810331Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2810332Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2810971Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. 2810972Protein automated matches [226835] (41 species)
    not a true protein
  7. 2811233Species Trichoderma reesei [TaxId:51453] [255994] (4 PDB entries)
  8. 2811235Domain d3ogva2: 3ogv A:394-571 [248266]
    Other proteins in same PDB: d3ogva1, d3ogva3, d3ogva4, d3ogva5
    automated match to d1tg7a4
    complexed with nag, ptq

Details for d3ogva2

PDB Entry: 3ogv (more details), 1.4 Å

PDB Description: complex structure of beta-galactosidase from trichoderma reesei with petg
PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d3ogva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ogva2 b.71.1.0 (A:394-571) automated matches {Trichoderma reesei [TaxId: 51453]}
gyitatpenatqgvysdsqnivitpllakesgdffvvrhanysstdtasytvklptsagd
ltipqlggsltltgrdskihvtdypvgkftllystaeiftwnefaektvlvlyggaqelh
efavknpfgssktakakkiegsnvtihttsnltvvlqwtassarqvvqlgslviymvd

SCOPe Domain Coordinates for d3ogva2:

Click to download the PDB-style file with coordinates for d3ogva2.
(The format of our PDB-style files is described here.)

Timeline for d3ogva2: