Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.0: automated matches [191314] (1 protein) not a true family |
Protein automated matches [190075] (60 species) not a true protein |
Species Trichoderma reesei [TaxId:51453] [225935] (5 PDB entries) |
Domain d3ogva1: 3ogv A:38-393 [248265] Other proteins in same PDB: d3ogva2, d3ogva3, d3ogva4, d3ogva5 automated match to d1tg7a5 complexed with nag, ptq |
PDB Entry: 3ogv (more details), 1.4 Å
SCOPe Domain Sequences for d3ogva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ogva1 c.1.8.0 (A:38-393) automated matches {Trichoderma reesei [TaxId: 51453]} akgplqnivtwdehslfvhgervvifsgevhpfrlpvpslyldvfhkikalgfntvsfyv dwallegkpgrfradgifslepffeaatkagiyllarpgpyinaevsgggfpgwlqrvkg klrtdapdylhatdnyvahiasiiakaqitnggpvilyqpeneysgaaegvlfpnkpymq yvidqarnagiivplinndafpggtgapgtglgsvdiyghdgyplgfdcahpsawpdngl pttwrqdhlnispstpfslvefqggafdpfggwgfeqcsalvnhefervfyknnmaagvt ifniymtfggtnwgnlghpggytsydygasiredrridrekyselklqgqflkvsp
Timeline for d3ogva1:
View in 3D Domains from same chain: (mouse over for more information) d3ogva2, d3ogva3, d3ogva4, d3ogva5 |