Class b: All beta proteins [48724] (176 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) |
Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
Protein automated matches [190770] (24 species) not a true protein |
Species Trichoderma reesei [TaxId:51453] [255996] (4 PDB entries) |
Domain d3ogsa4: 3ogs A:669-852 [248263] Other proteins in same PDB: d3ogsa1, d3ogsa2, d3ogsa3 automated match to d1tg7a2 complexed with ipt, nag |
PDB Entry: 3ogs (more details), 1.75 Å
SCOPe Domain Sequences for d3ogsa4:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ogsa4 b.18.1.0 (A:669-852) automated matches {Trichoderma reesei [TaxId: 51453]} iphvqvpeltklkwykvdslpeirsnyddsrwplanlrtsnntyaplktpvslygsdygf hagtllfrgrftartarqqlflstqggsafassvwlndrfigsftgfdaasaanssytld rlvrgrryiltvvvdstgldenwttgddsmkaprgildyaltsssganvsiswkltgnlg gedy
Timeline for d3ogsa4:
View in 3D Domains from same chain: (mouse over for more information) d3ogsa1, d3ogsa2, d3ogsa3, d3ogsa5 |