Class b: All beta proteins [48724] (176 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.0: automated matches [227134] (1 protein) not a true family |
Protein automated matches [226835] (30 species) not a true protein |
Species Trichoderma reesei [TaxId:51453] [255994] (4 PDB entries) |
Domain d3ogsa2: 3ogs A:394-571 [248261] Other proteins in same PDB: d3ogsa1, d3ogsa3, d3ogsa4, d3ogsa5 automated match to d1tg7a4 complexed with ipt, nag |
PDB Entry: 3ogs (more details), 1.75 Å
SCOPe Domain Sequences for d3ogsa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ogsa2 b.71.1.0 (A:394-571) automated matches {Trichoderma reesei [TaxId: 51453]} gyitatpenatqgvysdsqnivitpllakesgdffvvrhanysstdtasytvklptsagd ltipqlggsltltgrdskihvtdypvgkftllystaeiftwnefaektvlvlyggaqelh efavknpfgssktakakkiegsnvtihttsnltvvlqwtassarqvvqlgslviymvd
Timeline for d3ogsa2:
View in 3D Domains from same chain: (mouse over for more information) d3ogsa1, d3ogsa3, d3ogsa4, d3ogsa5 |