Lineage for d3og2a3 (3og2 A:572-668)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2825002Fold b.149: Beta-galactosidase LacA, domain 3 [117099] (1 superfamily)
    sandwich; 8 strands in 2 sheets
  4. 2825003Superfamily b.149.1: Beta-galactosidase LacA, domain 3 [117100] (2 families) (S)
    automatically mapped to Pfam PF13363
  5. 2825009Family b.149.1.0: automated matches [254310] (1 protein)
    not a true family
  6. 2825010Protein automated matches [254712] (3 species)
    not a true protein
  7. 2825020Species Trichoderma reesei [TaxId:51453] [255995] (4 PDB entries)
  8. 2825021Domain d3og2a3: 3og2 A:572-668 [248248]
    Other proteins in same PDB: d3og2a1, d3og2a2, d3og2a4, d3og2a5
    automated match to d1tg7a1
    complexed with gol, nag

Details for d3og2a3

PDB Entry: 3og2 (more details), 1.2 Å

PDB Description: native crystal structure of trichoderma reesei beta-galactosidase
PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d3og2a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3og2a3 b.149.1.0 (A:572-668) automated matches {Trichoderma reesei [TaxId: 51453]}
rnsaynywvptlpgsgkqsaygsslmnpdsviinggylirsvaikgnalsvqadfnvttp
leiigipkgisklavngkelgysvselgdwiahpaie

SCOPe Domain Coordinates for d3og2a3:

Click to download the PDB-style file with coordinates for d3og2a3.
(The format of our PDB-style files is described here.)

Timeline for d3og2a3: