SCOPe 2.06: Domain d3og2a2: 3og2 A:394-571

Lineage for d3og2a2 (3og2 A:394-571)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.0: automated matches [227134] (1 protein)
   not a true family

6. Protein automated matches [226835] (34 species)
   not a true protein

7. Species Trichoderma reesei [TaxId:51453] [255994] (4 PDB entries)

8. Domain d3og2a2: 3og2 A:394-571 [248247]
   Other proteins in same PDB: d3og2a1, d3og2a3, d3og2a4, d3og2a5
   automated match to d1tg7a4
   complexed with gol, nag

Details for d3og2a2

PDB Entry: 3og2, 1.2 Å

PDB Description: native crystal structure of trichoderma reesei beta-galactosidase

PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d3og2a2:

Sequence; same for both SEQRES and ATOM records:

>d3og2a2 b.71.1.0 (A:394-571) automated matches {Trichoderma reesei [TaxId: 51453]}
gyitatpenatqgvysdsqnivitpllakesgdffvvrhanysstdtasytvklptsagd
ltipqlggsltltgrdskihvtdypvgkftllystaeiftwnefaektvlvlyggaqelh
efavknpfgssktakakkiegsnvtihttsnltvvlqwtassarqvvqlgslviymvd

Timeline for d3og2a2:

• d3og2a2 first appeared in SCOPe 2.04
  
• d3og2a2 appears in SCOPe 2.05
  
• d3og2a2 appears in SCOPe 2.07
  
• d3og2a2 appears in the current release, SCOPe 2.08