Lineage for d3oehw1 (3oeh W:8-82)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2798607Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
    barrel, closed; n=6, S=8; greek-key
    Many cradle-loop superfamilies may be homologous, according to PubMed 18457946
  4. 2798608Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) (S)
    automatically mapped to Pfam PF02874
  5. 2798609Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (3 proteins)
    6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)
  6. 2798680Protein F1 ATP synthase beta subunit, domain 1 [88677] (5 species)
  7. 2798683Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310896] (6 PDB entries)
  8. 2798718Domain d3oehw1: 3oeh W:8-82 [248240]
    Other proteins in same PDB: d3oehd2, d3oehd3, d3oehe2, d3oehe3, d3oehf2, d3oehf3, d3oehg_, d3oehh1, d3oehh2, d3oehi_, d3oehm2, d3oehm3, d3oehn2, d3oehn3, d3oeho2, d3oeho3, d3oehp_, d3oehr_, d3oehv2, d3oehv3, d3oehw2, d3oehw3, d3oehx2, d3oehx3
    automated match to d2jdid2
    complexed with anp, mg; mutant

Details for d3oehw1

PDB Entry: 3oeh (more details), 3 Å

PDB Description: Structure of four mutant forms of yeast F1 ATPase: beta-V279F
PDB Compounds: (W:) ATP synthase subunit beta

SCOPe Domain Sequences for d3oehw1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oehw1 b.49.1.1 (W:8-82) F1 ATP synthase beta subunit, domain 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
pitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamdgt
eglvrgekvldtggp

SCOPe Domain Coordinates for d3oehw1:

Click to download the PDB-style file with coordinates for d3oehw1.
(The format of our PDB-style files is described here.)

Timeline for d3oehw1: