Class g: Small proteins [56992] (92 folds) |
Fold g.18: Complement control module/SCR domain [57534] (1 superfamily) disulfide-rich all-beta fold |
Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) |
Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins) Pfam PF00084 |
Protein automated matches [254612] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255501] (4 PDB entries) |
Domain d3oedc1: 3oed C:0-65 [248213] Other proteins in same PDB: d3oeda_, d3oedb_ automated match to d1ghqb1 |
PDB Entry: 3oed (more details), 3.16 Å
SCOPe Domain Sequences for d3oedc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3oedc1 g.18.1.1 (C:0-65) automated matches {Human (Homo sapiens) [TaxId: 9606]} giscgspppilngrisyystpiavgtviryscsgtfrligeksllcitkdkvdgtwdkpa pkceyf
Timeline for d3oedc1:
View in 3D Domains from other chains: (mouse over for more information) d3oeda_, d3oedb_, d3oedd1, d3oedd2 |