Lineage for d3oeca_ (3oec A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1580116Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1580117Protein automated matches [190069] (181 species)
    not a true protein
  7. 1581085Species Mycobacterium thermoresistibile [TaxId:1797] [255993] (1 PDB entry)
  8. 1581086Domain d3oeca_: 3oec A: [248207]
    automated match to d3pxxc_
    complexed with na

Details for d3oeca_

PDB Entry: 3oec (more details), 1.95 Å

PDB Description: crystal structure of carveol dehydrogenase from mycobacterium thermoresistibile
PDB Compounds: (A:) Carveol dehydrogenase (MythA.01326.c, A0R518 homolog)

SCOPe Domain Sequences for d3oeca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oeca_ c.2.1.0 (A:) automated matches {Mycobacterium thermoresistibile [TaxId: 1797]}
nrlqgkvafitgaargqgrthavrlaqdgadivaidlcrqqpnldyaqgspeelketvrl
veeqgrriiarqadvrdlaslqavvdealaefghidilvsnvgisnqgevvsltdqqwsd
ilqtnligawhacravlpsmiergqggsvifvsstvglrgapgqshyaaskhgvqglmls
lanevgrhnirvnsvnpgavntemalnekllkmflphlenptredaaelfsqltllpipw
vepedvsnavawlasdearyihgaaipvdggqlara

SCOPe Domain Coordinates for d3oeca_:

Click to download the PDB-style file with coordinates for d3oeca_.
(The format of our PDB-style files is described here.)

Timeline for d3oeca_: