SCOPe 2.04: Domain d3oe7w3: 3oe7 W:358-474

Lineage for d3oe7w3 (3oe7 W:358-474)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.69: Left-handed superhelix [47916] (4 superfamilies)
   core: 4-5 helices; bundle; left-handed superhelix

4. Superfamily a.69.1: C-terminal domain of alpha and beta subunits of F1 ATP synthase [47917] (2 families)

5. Family a.69.1.0: automated matches [254233] (1 protein)
   not a true family

6. Protein automated matches [254528] (6 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [255214] (6 PDB entries)

8. Domain d3oe7w3: 3oe7 W:358-474 [248203]
   Other proteins in same PDB: d3oe7d1, d3oe7d2, d3oe7e1, d3oe7e2, d3oe7f1, d3oe7f2, d3oe7g_, d3oe7m1, d3oe7m2, d3oe7n1, d3oe7n2, d3oe7o1, d3oe7o2, d3oe7p_, d3oe7v1, d3oe7v2, d3oe7w1, d3oe7w2, d3oe7x1, d3oe7x2
   automated match to d2jdid1
   complexed with anp, mg, po4; mutant

Details for d3oe7w3

PDB Entry: 3oe7, 3.19 Å

PDB Description: Structure of four mutant forms of yeast f1 ATPase: gamma-I270T

PDB Compounds: (W:) ATP synthase subunit beta

SCOPe Domain Sequences for d3oe7w3:

Sequence; same for both SEQRES and ATOM records:

>d3oe7w3 a.69.1.0 (W:358-474) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ldaavvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqp
favaevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaekla

Timeline for d3oe7w3:

• d3oe7w3 is new in SCOPe 2.04-stable
  
• d3oe7w3 appears in SCOPe 2.05
  
• d3oe7w3 appears in the current release, SCOPe 2.07