Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest |
Superfamily c.49.2: ATP synthase (F1-ATPase), gamma subunit [52943] (2 families) contains an antiparallel coiled coil formed by N- and C-terminal extensions to the common fold |
Family c.49.2.1: ATP synthase (F1-ATPase), gamma subunit [52944] (1 protein) automatically mapped to Pfam PF00231 |
Protein F1 ATP synthase gamma subunit [52945] (4 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310899] (6 PDB entries) |
Domain d3oe7p_: 3oe7 P: [248197] Other proteins in same PDB: d3oe7d1, d3oe7d2, d3oe7d3, d3oe7e1, d3oe7e2, d3oe7e3, d3oe7f1, d3oe7f2, d3oe7f3, d3oe7h1, d3oe7h2, d3oe7i_, d3oe7m1, d3oe7m2, d3oe7m3, d3oe7n1, d3oe7n2, d3oe7n3, d3oe7o1, d3oe7o2, d3oe7o3, d3oe7r_, d3oe7v1, d3oe7v2, d3oe7v3, d3oe7w1, d3oe7w2, d3oe7w3, d3oe7x1, d3oe7x2, d3oe7x3 automated match to d2v7qg_ complexed with anp, mg, po4; mutant |
PDB Entry: 3oe7 (more details), 3.19 Å
SCOPe Domain Sequences for d3oe7p_:
Sequence, based on SEQRES records: (download)
>d3oe7p_ c.49.2.1 (P:) F1 ATP synthase gamma subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} atlkevemrlksikniekitktmkivastrlskaekakisakkmdeaeqlfyknaetknl dveatetgapkelivaitsdkglcgsihsqlakavrrhlndqpnadivtigdkikmqllr thpnniklsingigkdaptfqesaliadkllsvmkagtypkisifyndpvsslsfepsek pifnaktieqspsfgkfeidtdanvprdlfeytlanqmltamaqgyaaeisarrnamdna sknagdminrysilynrtrqavitnelvdtitgass
>d3oe7p_ c.49.2.1 (P:) F1 ATP synthase gamma subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} atlkevemrlksikniekitktmkivastrlskaekakisakkmdeaeqlfyknaetkke livaitsdkglcgsihsqlakavrrhlndqpnadivtigdkikmhpiklsingigkdapt fqesaliadkllsvmkagtypkisifyndpvssfepsekpifnaktidtdanvprdlfey tlanqmltamaqgyaaeisarrnamdnasknagdminrysilynrtrqavitnelvdtit gass
Timeline for d3oe7p_:
View in 3D Domains from other chains: (mouse over for more information) d3oe7d1, d3oe7d2, d3oe7d3, d3oe7e1, d3oe7e2, d3oe7e3, d3oe7f1, d3oe7f2, d3oe7f3, d3oe7g_, d3oe7h1, d3oe7h2, d3oe7i_, d3oe7m1, d3oe7m2, d3oe7m3, d3oe7n1, d3oe7n2, d3oe7n3, d3oe7o1, d3oe7o2, d3oe7o3, d3oe7r_, d3oe7v1, d3oe7v2, d3oe7v3, d3oe7w1, d3oe7w2, d3oe7w3, d3oe7x1, d3oe7x2, d3oe7x3 |