Lineage for d3oe7p_ (3oe7 P:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2135454Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest
  4. 2135614Superfamily c.49.2: ATP synthase (F1-ATPase), gamma subunit [52943] (2 families) (S)
    contains an antiparallel coiled coil formed by N- and C-terminal extensions to the common fold
  5. 2135615Family c.49.2.1: ATP synthase (F1-ATPase), gamma subunit [52944] (1 protein)
    automatically mapped to Pfam PF00231
  6. 2135616Protein F1 ATP synthase gamma subunit [52945] (4 species)
  7. 2135617Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310899] (6 PDB entries)
  8. 2135627Domain d3oe7p_: 3oe7 P: [248197]
    Other proteins in same PDB: d3oe7d1, d3oe7d2, d3oe7d3, d3oe7e1, d3oe7e2, d3oe7e3, d3oe7f1, d3oe7f2, d3oe7f3, d3oe7h1, d3oe7h2, d3oe7i_, d3oe7m1, d3oe7m2, d3oe7m3, d3oe7n1, d3oe7n2, d3oe7n3, d3oe7o1, d3oe7o2, d3oe7o3, d3oe7r_, d3oe7v1, d3oe7v2, d3oe7v3, d3oe7w1, d3oe7w2, d3oe7w3, d3oe7x1, d3oe7x2, d3oe7x3
    automated match to d2v7qg_
    complexed with anp, mg, po4; mutant

Details for d3oe7p_

PDB Entry: 3oe7 (more details), 3.19 Å

PDB Description: Structure of four mutant forms of yeast f1 ATPase: gamma-I270T
PDB Compounds: (P:) ATP synthase subunit gamma

SCOPe Domain Sequences for d3oe7p_:

Sequence, based on SEQRES records: (download)

>d3oe7p_ c.49.2.1 (P:) F1 ATP synthase gamma subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
atlkevemrlksikniekitktmkivastrlskaekakisakkmdeaeqlfyknaetknl
dveatetgapkelivaitsdkglcgsihsqlakavrrhlndqpnadivtigdkikmqllr
thpnniklsingigkdaptfqesaliadkllsvmkagtypkisifyndpvsslsfepsek
pifnaktieqspsfgkfeidtdanvprdlfeytlanqmltamaqgyaaeisarrnamdna
sknagdminrysilynrtrqavitnelvdtitgass

Sequence, based on observed residues (ATOM records): (download)

>d3oe7p_ c.49.2.1 (P:) F1 ATP synthase gamma subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
atlkevemrlksikniekitktmkivastrlskaekakisakkmdeaeqlfyknaetkke
livaitsdkglcgsihsqlakavrrhlndqpnadivtigdkikmhpiklsingigkdapt
fqesaliadkllsvmkagtypkisifyndpvssfepsekpifnaktidtdanvprdlfey
tlanqmltamaqgyaaeisarrnamdnasknagdminrysilynrtrqavitnelvdtit
gass

SCOPe Domain Coordinates for d3oe7p_:

Click to download the PDB-style file with coordinates for d3oe7p_.
(The format of our PDB-style files is described here.)

Timeline for d3oe7p_: