Lineage for d1syd__ (1syd -)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 462779Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 462780Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family) (S)
  5. 462781Family b.40.1.1: Staphylococcal nuclease [50200] (1 protein)
    barrel, closed; n=5, S=10
  6. 462782Protein Staphylococcal nuclease [50201] (1 species)
  7. 462783Species Staphylococcus aureus [TaxId:1280] [50202] (65 PDB entries)
  8. 462792Domain d1syd__: 1syd - [24819]

Details for d1syd__

PDB Entry: 1syd (more details), 1.7 Å

PDB Description: engineering alternative beta-turn types in staphylococcal nuclease

SCOP Domain Sequences for d1syd__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1syd__ b.40.1.1 (-) Staphylococcal nuclease {Staphylococcus aureus}
klhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasaftkkm
venakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykgnntheqhl
rkseaqakkeklniws

SCOP Domain Coordinates for d1syd__:

Click to download the PDB-style file with coordinates for d1syd__.
(The format of our PDB-style files is described here.)

Timeline for d1syd__: