SCOPe 2.06: Domain d3oe7d1: 3oe7 D:6-82

Lineage for d3oe7d1 (3oe7 D:6-82)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
   barrel, closed; n=6, S=8; greek-key

4. Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families)
   automatically mapped to Pfam PF02874

5. Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins)
   6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)

6. Protein F1 ATP synthase beta subunit, domain 1 [88677] (5 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310896] (6 PDB entries)

8. Domain d3oe7d1: 3oe7 D:6-82 [248178]
   Other proteins in same PDB: d3oe7d2, d3oe7d3, d3oe7e2, d3oe7e3, d3oe7f2, d3oe7f3, d3oe7g_, d3oe7h1, d3oe7h2, d3oe7i_, d3oe7m2, d3oe7m3, d3oe7n2, d3oe7n3, d3oe7o2, d3oe7o3, d3oe7p_, d3oe7r_, d3oe7v2, d3oe7v3, d3oe7w2, d3oe7w3, d3oe7x2, d3oe7x3
   automated match to d2jdid2
   complexed with anp, mg, po4; mutant

Details for d3oe7d1

PDB Entry: 3oe7, 3.19 Å

PDB Description: Structure of four mutant forms of yeast f1 ATPase: gamma-I270T

PDB Compounds: (D:) ATP synthase subunit beta

SCOPe Domain Sequences for d3oe7d1:

Sequence; same for both SEQRES and ATOM records:

>d3oe7d1 b.49.1.1 (D:6-82) F1 ATP synthase beta subunit, domain 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
stpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamd
gteglvrgekvldtggp

Timeline for d3oe7d1:

• d3oe7d1 first appeared in SCOPe 2.04
  
• d3oe7d1 appears in SCOPe 2.05
  
• d3oe7d1 appears in SCOPe 2.07
  
• d3oe7d1 appears in the current release, SCOPe 2.08