Class b: All beta proteins [48724] (177 folds) |
Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies) barrel, closed; n=6, S=8; greek-key |
Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) automatically mapped to Pfam PF02874 |
Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins) 6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?) |
Protein F1 ATP synthase beta subunit, domain 1 [88677] (5 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [310896] (6 PDB entries) |
Domain d3oe7d1: 3oe7 D:6-82 [248178] Other proteins in same PDB: d3oe7d2, d3oe7d3, d3oe7e2, d3oe7e3, d3oe7f2, d3oe7f3, d3oe7g_, d3oe7h1, d3oe7h2, d3oe7i_, d3oe7m2, d3oe7m3, d3oe7n2, d3oe7n3, d3oe7o2, d3oe7o3, d3oe7p_, d3oe7r_, d3oe7v2, d3oe7v3, d3oe7w2, d3oe7w3, d3oe7x2, d3oe7x3 automated match to d2jdid2 complexed with anp, mg, po4; mutant |
PDB Entry: 3oe7 (more details), 3.19 Å
SCOPe Domain Sequences for d3oe7d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3oe7d1 b.49.1.1 (D:6-82) F1 ATP synthase beta subunit, domain 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} stpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamd gteglvrgekvldtggp
Timeline for d3oe7d1:
View in 3D Domains from other chains: (mouse over for more information) d3oe7e1, d3oe7e2, d3oe7e3, d3oe7f1, d3oe7f2, d3oe7f3, d3oe7g_, d3oe7h1, d3oe7h2, d3oe7i_, d3oe7m1, d3oe7m2, d3oe7m3, d3oe7n1, d3oe7n2, d3oe7n3, d3oe7o1, d3oe7o2, d3oe7o3, d3oe7p_, d3oe7r_, d3oe7v1, d3oe7v2, d3oe7v3, d3oe7w1, d3oe7w2, d3oe7w3, d3oe7x1, d3oe7x2, d3oe7x3 |