Lineage for d3o94c_ (3o94 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2864173Fold c.33: Isochorismatase-like hydrolases [52498] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2864174Superfamily c.33.1: Isochorismatase-like hydrolases [52499] (2 families) (S)
  5. 2864227Family c.33.1.0: automated matches [191389] (1 protein)
    not a true family
  6. 2864228Protein automated matches [190499] (26 species)
    not a true protein
  7. 2864366Species Streptococcus pneumoniae [TaxId:170187] [255991] (5 PDB entries)
  8. 2864369Domain d3o94c_: 3o94 C: [248147]
    automated match to d3hb7b_
    complexed with nca, zn

Details for d3o94c_

PDB Entry: 3o94 (more details), 1.6 Å

PDB Description: high resolution crystal structures of streptococcus pneumoniae nicotinamidase with trapped intermediates provide insights into catalytic mechanism and inhibition by aldehydes
PDB Compounds: (C:) Nicotinamidase

SCOPe Domain Sequences for d3o94c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3o94c_ c.33.1.0 (C:) automated matches {Streptococcus pneumoniae [TaxId: 170187]}
mtkalisidytedfvadsgkltagapaqaisdaiskvtrlafergdyifftidaheendc
fhpesklfpphnligtsgrnlygdlgifyqehgsdsrvfwmdkrhysafsgtdldirlre
rrvstviltgvltdisvlhtaidaynlgydieivkpavasiwpenhqfalghfkntlgak
lvdenlnelf

SCOPe Domain Coordinates for d3o94c_:

Click to download the PDB-style file with coordinates for d3o94c_.
(The format of our PDB-style files is described here.)

Timeline for d3o94c_: