Lineage for d3nxla1 (3nxl A:158-465)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1573508Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 1573839Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 1573840Protein automated matches [226923] (59 species)
    not a true protein
  7. 1573929Species Burkholderia sp. [TaxId:269483] [255988] (1 PDB entry)
  8. 1573930Domain d3nxla1: 3nxl A:158-465 [248099]
    automated match to d4hn8a2
    complexed with co3, mg

Details for d3nxla1

PDB Entry: 3nxl (more details), 1.89 Å

PDB Description: crystal structure of glucarate dehydratase from burkholderia cepacia complexed with magnesium
PDB Compounds: (A:) glucarate dehydratase

SCOPe Domain Sequences for d3nxla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nxla1 c.1.11.0 (A:158-465) automated matches {Burkholderia sp. [TaxId: 269483]}
egqqrdavpmlaylfyigdrgrtdlpyrdeaqartpwfrlrneealtpaaiarqaeaavd
rygfadfklkggvmagademeaiaaikacfpdaratldpngawsldeavalcrgqghlla
yaedpcgpeggysgrevmaefrratgiptatnmiatdwrqmdhavrlqavdipladphfw
tmqgsvrlaqlcrdwgltwgshsnnhfdvslamfthaaaaapgtitaidthwiwqegdar
ltreplkivggqvavperpglgieldmaqveaahalykevggtarddavamrylvpgwty
dpkrpsfg

SCOPe Domain Coordinates for d3nxla1:

Click to download the PDB-style file with coordinates for d3nxla1.
(The format of our PDB-style files is described here.)

Timeline for d3nxla1: