SCOP 1.57: Domain d1d3bl_: 1d3b L:

Lineage for d1d3bl_ (1d3b L:)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.38: Sm motif of small nuclear ribonucleoproteins, SNRNP [50181] (1 superfamily)

4. Superfamily b.38.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50182] (1 family)

5. Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (5 proteins)

6. Protein B core SNRNP protein [50190] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50191] (1 PDB entry)

8. Domain d1d3bl_: 1d3b L: [24809]
   Other proteins in same PDB: d1d3ba_, d1d3bc_, d1d3be_, d1d3bg_, d1d3bi_, d1d3bk_

Details for d1d3bl_

PDB Entry: 1d3b, 2 Å

PDB Description: crystal structure of the d3b subcomplex of the human core snrnp domain at 2.0a resolution

SCOP Domain Sequences for d1d3bl_:

Sequence; same for both SEQRES and ATOM records:

>d1d3bl_ b.38.1.1 (L:) B core SNRNP protein {Human (Homo sapiens)}
tvgksskmlqhidyrmrcilqdgrifigtfkafdkhmnlilcdcdefrkikpknskqaer
eekrvlglvllrgenlvsmtvegpppkdtg

Timeline for d1d3bl_:

• d1d3bl_ first appeared (with stable ids) in SCOP 1.55
  
• d1d3bl_ appears in SCOP 1.59
  
• d1d3bl_ appears in the current release, SCOPe 2.08