Lineage for d3nvzk1 (3nvz K:224-414)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2593699Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 2593700Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 2593796Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (6 proteins)
    automatically mapped to Pfam PF00941
  6. 2593855Protein automated matches [232070] (2 species)
    not a true protein
  7. 2593856Species Cow (Bos taurus) [TaxId:9913] [232074] (11 PDB entries)
  8. 2593864Domain d3nvzk1: 3nvz K:224-414 [248073]
    Other proteins in same PDB: d3nvza1, d3nvza2, d3nvzb2, d3nvzc1, d3nvzc2, d3nvzj1, d3nvzj2, d3nvzk2, d3nvzl1, d3nvzl2
    automated match to d3eub31
    complexed with fad, fes, i3a, mos, mte

Details for d3nvzk1

PDB Entry: 3nvz (more details), 1.6 Å

PDB Description: Crystal Structure of Bovine Xanthine Oxidase in Complex with Indole-3-Aldehyde
PDB Compounds: (K:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3nvzk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nvzk1 d.145.1.3 (K:224-414) automated matches {Cow (Bos taurus) [TaxId: 9913]}
pkqlrfegervtwiqastlkelldlkaqhpeaklvvgnteigiemkfknqlfpmiicpaw
ipelnavehgpegisfgaacalssvektlleavaklptqktevfrgvleqlrwfagkqvk
svaslggniitaspisdlnpvfmasgtkltivsrgtrrtvpmdhtffpsyrktllgpeei
llsieipysre

SCOPe Domain Coordinates for d3nvzk1:

Click to download the PDB-style file with coordinates for d3nvzk1.
(The format of our PDB-style files is described here.)

Timeline for d3nvzk1: