| Class b: All beta proteins [48724] (104 folds) |
| Fold b.38: Sm motif of small nuclear ribonucleoproteins, SNRNP [50181] (1 superfamily) |
Superfamily b.38.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50182] (1 family) ![]() |
| Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (5 proteins) |
| Protein B core SNRNP protein [50190] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [50191] (1 PDB entry) |
| Domain d1d3bh_: 1d3b H: [24807] Other proteins in same PDB: d1d3ba_, d1d3bc_, d1d3be_, d1d3bg_, d1d3bi_, d1d3bk_ |
PDB Entry: 1d3b (more details), 2 Å
SCOP Domain Sequences for d1d3bh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d3bh_ b.38.1.1 (H:) B core SNRNP protein {Human (Homo sapiens)}
vgksskmlqhidyrmrcilqdgrifigtfkafdkhmnlilcdcdefrkikpknskqaere
ekrvlglvllrgenlvsmtvegpppk
Timeline for d1d3bh_: