SCOPe 2.04: Domain d3nvzc1: 3nvz C:571-694

Lineage for d3nvzc1 (3nvz C:571-694)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
   core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids

4. Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (2 families)

5. Family d.41.1.0: automated matches [230464] (1 protein)
   not a true family

6. Protein automated matches [230465] (2 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [232071] (9 PDB entries)

8. Domain d3nvzc1: 3nvz C:571-694 [248069]
   Other proteins in same PDB: d3nvza1, d3nvza2, d3nvzb1, d3nvzb2, d3nvzc2, d3nvzj1, d3nvzj2, d3nvzk1, d3nvzk2, d3nvzl2
   automated match to d3etrc1
   complexed with fad, fes, i3a, mos, mte

Details for d3nvzc1

PDB Entry: 3nvz, 1.6 Å

PDB Description: Crystal Structure of Bovine Xanthine Oxidase in Complex with Indole-3-Aldehyde

PDB Compounds: (C:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3nvzc1:

Sequence; same for both SEQRES and ATOM records:

>d3nvzc1 d.41.1.0 (C:571-694) automated matches {Cow (Bos taurus) [TaxId: 9913]}
dtvgrplphlaaamqasgeavycddipryenelflrlvtstrahakiksidvseaqkvpg
fvcflsaddipgsnetglfndetvfakdtvtcvghiigavvadtpehaeraahvvkvtye
dlpa

Timeline for d3nvzc1:

• d3nvzc1 is new in SCOPe 2.04-stable
  
• d3nvzc1 appears in SCOPe 2.05
  
• d3nvzc1 appears in the current release, SCOPe 2.08