Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies) core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids |
Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (2 families) |
Family d.41.1.0: automated matches [230464] (1 protein) not a true family |
Protein automated matches [230465] (2 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [232071] (9 PDB entries) |
Domain d3nvzc1: 3nvz C:571-694 [248069] Other proteins in same PDB: d3nvza1, d3nvza2, d3nvzb1, d3nvzb2, d3nvzc2, d3nvzj1, d3nvzj2, d3nvzk1, d3nvzk2, d3nvzl2 automated match to d3etrc1 complexed with fad, fes, i3a, mos, mte |
PDB Entry: 3nvz (more details), 1.6 Å
SCOPe Domain Sequences for d3nvzc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nvzc1 d.41.1.0 (C:571-694) automated matches {Cow (Bos taurus) [TaxId: 9913]} dtvgrplphlaaamqasgeavycddipryenelflrlvtstrahakiksidvseaqkvpg fvcflsaddipgsnetglfndetvfakdtvtcvghiigavvadtpehaeraahvvkvtye dlpa
Timeline for d3nvzc1: