Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies) core: beta(3,4)-alpha(3); alpha+beta sandwich |
Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families) automatically mapped to Pfam PF03450 |
Family d.87.2.0: automated matches [232089] (1 protein) not a true family |
Protein automated matches [232090] (4 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [232091] (11 PDB entries) |
Domain d3nvzb2: 3nvz B:415-528 [248068] Other proteins in same PDB: d3nvza1, d3nvza2, d3nvzb1, d3nvzc1, d3nvzc2, d3nvzj1, d3nvzj2, d3nvzk1, d3nvzl1, d3nvzl2 automated match to d3eub32 complexed with fad, fes, i3a, mos, mte |
PDB Entry: 3nvz (more details), 1.6 Å
SCOPe Domain Sequences for d3nvzb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3nvzb2 d.87.2.0 (B:415-528) automated matches {Cow (Bos taurus) [TaxId: 9913]} deffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkql skfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltvlkklg
Timeline for d3nvzb2: