SCOPe 2.04: Domain d3nvyl1: 3nvy L:571-694

Lineage for d3nvyl1 (3nvy L:571-694)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
   core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids

4. Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (2 families)

5. Family d.41.1.0: automated matches [230464] (1 protein)
   not a true family

6. Protein automated matches [230465] (2 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [232071] (9 PDB entries)

8. Domain d3nvyl1: 3nvy L:571-694 [248063]
   Other proteins in same PDB: d3nvya1, d3nvya2, d3nvyb1, d3nvyb2, d3nvyc2, d3nvyj1, d3nvyj2, d3nvyk1, d3nvyk2, d3nvyl2
   automated match to d3nrzc1
   complexed with fad, fes, mos, mte, que

Details for d3nvyl1

PDB Entry: 3nvy, 2 Å

PDB Description: Crystal Structure of Bovine Xanthine Oxidase in Complex with Quercetin

PDB Compounds: (L:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3nvyl1:

Sequence; same for both SEQRES and ATOM records:

>d3nvyl1 d.41.1.0 (L:571-694) automated matches {Cow (Bos taurus) [TaxId: 9913]}
dtvgrplphlaaamqasgeavycddipryenelflrlvtstrahakiksidvseaqkvpg
fvcflsaddipgsnetglfndetvfakdtvtcvghiigavvadtpehaeraahvvkvtye
dlpa

Timeline for d3nvyl1:

• d3nvyl1 is new in SCOPe 2.04-stable
  
• d3nvyl1 appears in SCOPe 2.05
  
• d3nvyl1 appears in the current release, SCOPe 2.08