Lineage for d3nvwj2 (3nvw J:93-165)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000915Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
    core: 4 helices, bundle
  4. 2000916Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families) (S)
    contains 2Fe-2S cluster
  5. 2000917Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (7 proteins)
  6. 2000999Protein automated matches [232101] (1 species)
    not a true protein
  7. 2001000Species Cow (Bos taurus) [TaxId:9913] [232106] (10 PDB entries)
  8. 2001002Domain d3nvwj2: 3nvw J:93-165 [248048]
    Other proteins in same PDB: d3nvwa1, d3nvwb1, d3nvwb2, d3nvwc1, d3nvwc2, d3nvwj1, d3nvwk1, d3nvwk2, d3nvwl1, d3nvwl2
    automated match to d3etrl2
    complexed with fad, fes, gun, mos, mte

Details for d3nvwj2

PDB Entry: 3nvw (more details), 1.6 Å

PDB Description: Crystal Structure of Bovine Xanthine Oxidase in Complex with Guanine
PDB Compounds: (J:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3nvwj2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nvwj2 a.56.1.1 (J:93-165) automated matches {Cow (Bos taurus) [TaxId: 9913]}
stktrlhpvqeriakshgsqcgfctpgivmsmytllrnqpeptveeiedafqgnlcrctg
yrpilqgfrtfak

SCOPe Domain Coordinates for d3nvwj2:

Click to download the PDB-style file with coordinates for d3nvwj2.
(The format of our PDB-style files is described here.)

Timeline for d3nvwj2: