SCOPe 2.04: Domain d3ns1l1: 3ns1 L:571-694

Lineage for d3ns1l1 (3ns1 L:571-694)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
   core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids

4. Superfamily d.41.1: CO dehydrogenase molybdoprotein N-domain-like [54665] (2 families)

5. Family d.41.1.0: automated matches [230464] (1 protein)
   not a true family

6. Protein automated matches [230465] (2 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [232071] (9 PDB entries)

8. Domain d3ns1l1: 3ns1 L:571-694 [248011]
   Other proteins in same PDB: d3ns1a1, d3ns1a2, d3ns1b1, d3ns1b2, d3ns1c2, d3ns1j1, d3ns1j2, d3ns1k1, d3ns1k2, d3ns1l2
   automated match to d3etrc1
   complexed with fad, fes, mos, mte, pm6

Details for d3ns1l1

PDB Entry: 3ns1, 2.6 Å

PDB Description: Crystal Structure of Bovine Xanthine Oxidase in Complex with 6-Mercaptopurine

PDB Compounds: (L:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3ns1l1:

Sequence; same for both SEQRES and ATOM records:

>d3ns1l1 d.41.1.0 (L:571-694) automated matches {Cow (Bos taurus) [TaxId: 9913]}
dtvgrplphlaaamqasgeavycddipryenelflrlvtstrahakiksidvseaqkvpg
fvcflsaddipgsnetglfndetvfakdtvtcvghiigavvadtpehaeraahvvkvtye
dlpa

Timeline for d3ns1l1:

• d3ns1l1 is new in SCOPe 2.04-stable
  
• d3ns1l1 appears in SCOPe 2.05
  
• d3ns1l1 appears in the current release, SCOPe 2.08