Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) |
Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins) |
Protein automated matches [231466] (4 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [232069] (10 PDB entries) |
Domain d3ns1a1: 3ns1 A:2-92 [248001] Other proteins in same PDB: d3ns1a2, d3ns1b1, d3ns1b2, d3ns1c1, d3ns1c2, d3ns1j2, d3ns1k1, d3ns1k2, d3ns1l1, d3ns1l2 automated match to d3etrl1 complexed with fad, fes, mos, mte, pm6 |
PDB Entry: 3ns1 (more details), 2.6 Å
SCOPe Domain Sequences for d3ns1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ns1a1 d.15.4.2 (A:2-92) automated matches {Cow (Bos taurus) [TaxId: 9913]} tadelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrl qdkiihfsanaclapictlhhvavttvegig
Timeline for d3ns1a1: