Lineage for d3ns1a1 (3ns1 A:2-92)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2179170Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2179355Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)
  6. 2179518Protein automated matches [231466] (4 species)
    not a true protein
  7. 2179519Species Cow (Bos taurus) [TaxId:9913] [232069] (10 PDB entries)
  8. 2179536Domain d3ns1a1: 3ns1 A:2-92 [248001]
    Other proteins in same PDB: d3ns1a2, d3ns1b1, d3ns1b2, d3ns1c1, d3ns1c2, d3ns1j2, d3ns1k1, d3ns1k2, d3ns1l1, d3ns1l2
    automated match to d3etrl1
    complexed with fad, fes, mos, mte, pm6

Details for d3ns1a1

PDB Entry: 3ns1 (more details), 2.6 Å

PDB Description: Crystal Structure of Bovine Xanthine Oxidase in Complex with 6-Mercaptopurine
PDB Compounds: (A:) Xanthine dehydrogenase/oxidase

SCOPe Domain Sequences for d3ns1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ns1a1 d.15.4.2 (A:2-92) automated matches {Cow (Bos taurus) [TaxId: 9913]}
tadelvffvngkkvveknadpettllaylrrklglrgtklgcgeggcgactvmlskydrl
qdkiihfsanaclapictlhhvavttvegig

SCOPe Domain Coordinates for d3ns1a1:

Click to download the PDB-style file with coordinates for d3ns1a1.
(The format of our PDB-style files is described here.)

Timeline for d3ns1a1: