Lineage for d3nn8g_ (3nn8 G:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2023921Protein automated matches [190119] (22 species)
    not a true protein
  7. 2024733Species Mouse (Mus musculus) [TaxId:10090] [186842] (156 PDB entries)
  8. 2024969Domain d3nn8g_: 3nn8 G: [247971]
    automated match to d1ktrh_

Details for d3nn8g_

PDB Entry: 3nn8 (more details), 3.1 Å

PDB Description: Crystal structure of engineered antibody fragment based on 3D5
PDB Compounds: (G:) Engineered scFv, heavy chain

SCOPe Domain Sequences for d3nn8g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nn8g_ b.1.1.1 (G:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qvqlqqsgpedvkpgasvkisckasgyslstsgmgvnwvkqspgkglewlahiywdddkr
ynpslksratltvdktsstvylelrsltsedssvyycarrggsshyyamdywgqgttvtv
s

SCOPe Domain Coordinates for d3nn8g_:

Click to download the PDB-style file with coordinates for d3nn8g_.
(The format of our PDB-style files is described here.)

Timeline for d3nn8g_: