Lineage for d1b34b_ (1b34 B:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 58846Fold b.38: Sm motif of small nuclear ribonucleoproteins, SNRNP [50181] (1 superfamily)
  4. 58847Superfamily b.38.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50182] (1 family) (S)
  5. 58848Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (5 proteins)
  6. 58920Protein D2 core SNRNP protein [50186] (1 species)
  7. 58921Species Human (Homo sapiens) [TaxId:9606] [50187] (1 PDB entry)
  8. 58922Domain d1b34b_: 1b34 B: [24797]
    Other proteins in same PDB: d1b34a_

Details for d1b34b_

PDB Entry: 1b34 (more details), 2.5 Å

PDB Description: crystal structure of the d1d2 sub-complex from the human snrnp core domain

SCOP Domain Sequences for d1b34b_:

Sequence, based on SEQRES records: (download)

>d1b34b_ b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo sapiens)}
tgplsvltqsvknntqvlincrnnkkllgrvkafdrhcnmvlenvkemwtevpksgkgkk
kskpvnkdryiskmflrgdsvivvlrnpliagk

Sequence, based on observed residues (ATOM records): (download)

>d1b34b_ b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo sapiens)}
tgplsvltqsvknntqvlincrnnkkllgrvkafdrhcnmvlenvkemdryiskmflrgd
svivvlrnpliagk

SCOP Domain Coordinates for d1b34b_:

Click to download the PDB-style file with coordinates for d1b34b_.
(The format of our PDB-style files is described here.)

Timeline for d1b34b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1b34a_