SCOPe 2.05: Domain d3nm8a_: 3nm8 A:

Lineage for d3nm8a_ (3nm8 A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily)
   multihelical

4. Superfamily a.86.1: Di-copper centre-containing domain [48056] (4 families)
   duplication: contains two structural repeats

5. Family a.86.1.0: automated matches [254307] (1 protein)
   not a true family

6. Protein automated matches [254708] (1 species)
   not a true protein

7. Species Bacillus megaterium [TaxId:1404] [255981] (15 PDB entries)

8. Domain d3nm8a_: 3nm8 A: [247958]
   automated match to d2ahka_
   complexed with cl, cu, zn

Details for d3nm8a_

PDB Entry: 3nm8, 2 Å

PDB Description: Crystal structure of Tyrosinase from Bacillus megaterium

PDB Compounds: (A:) tyrosinase

SCOPe Domain Sequences for d3nm8a_:

Sequence; same for both SEQRES and ATOM records:

>d3nm8a_ a.86.1.0 (A:) automated matches {Bacillus megaterium [TaxId: 1404]}
kyrvrknvlhltdtekrdfvrtvlilkekgiydryiawhgaagkfhtppgsdrnaahmss
aflpwhreyllrferdlqsinpevtlpywewetdaqmqdpsqsqiwsadfmggngnpikd
fivdtgpfaagrwttideqgnpsgglkrnfgatkeaptlptrddvlnalkitqydtppwd
mtsqnsfrnqlegfingpqlhnrvhrwvggqmgvvptapndpvfflhhanvdriwavwqi
ihrnqnyqpmkngpfgqnfrdpmypwnttpedvmnhrklgyvydi

Timeline for d3nm8a_:

• d3nm8a_ first appeared in SCOPe 2.04
  
• d3nm8a_ appears in SCOPe 2.06
  
• d3nm8a_ appears in the current release, SCOPe 2.08