SCOPe 2.08: Domain d3nipb_: 3nip B:

Lineage for d3nipb_ (3nip B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456

4. Superfamily c.42.1: Arginase/deacetylase [52768] (3 families)

5. Family c.42.1.0: automated matches [191435] (1 protein)
   not a true family

6. Protein automated matches [190626] (14 species)
   not a true protein

7. Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [189976] (3 PDB entries)

8. Domain d3nipb_: 3nip B: [247938]
   automated match to d1gq6a_
   complexed with 16d

Details for d3nipb_

PDB Entry: 3nip, 2.5 Å

PDB Description: Crystal structure of Pseudomonas aeruginosa guanidinopropionase complexed with 1,6-diaminohexane

PDB Compounds: (B:) 3-guanidinopropionase

SCOPe Domain Sequences for d3nipb_:

Sequence; same for both SEQRES and ATOM records:

>d3nipb_ c.42.1.0 (B:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
ndhpqpldaaeiprfagiptfmrlpaftdpaalqvgligvpwdggttnragarhgprevr
nlsslmrkvhhvsriapydlvrvgdlgdapvnpidlldslrriegfyrqvhaagtlplsv
ggdhlvtlpifralgrerplgmvhfdahsdtndryfgdnpythgtpfrraieeglldplr
tvqigirgsvyspdddafarecgirvihmeefvelgveatlaearrvvgagptyvsfdvd
vldpafapgtgtpeiggmtslqaqqlvrglrgldlvgadvvevsppfdvggatalvgatm
mfellcllaesaarsa

Timeline for d3nipb_:

• d3nipb_ first appeared in SCOPe 2.04
  
• d3nipb_ appears in SCOPe 2.07