Lineage for d3ni8a1 (3ni8 A:19-157)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2214642Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2214908Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2215232Family d.129.3.0: automated matches [191339] (1 protein)
    not a true family
  6. 2215233Protein automated matches [190218] (22 species)
    not a true protein
  7. 2215375Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [255979] (1 PDB entry)
  8. 2215376Domain d3ni8a1: 3ni8 A:19-157 [247935]
    Other proteins in same PDB: d3ni8a2
    automated match to d1x53a1
    complexed with gol, ipa

Details for d3ni8a1

PDB Entry: 3ni8 (more details), 2.5 Å

PDB Description: crystal structure of pfc0360w, an hsp90 activator from plasmodium falciparum
PDB Compounds: (A:) PFC0360w protein

SCOPe Domain Sequences for d3ni8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ni8a1 d.129.3.0 (A:19-157) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
msfeiteeyyvppevlfnaftdaytltrlsrgslaevdlkvggkfslfsgsilgefteit
kphkivekwkfrdwnecdystvtvefisvkenhtklklthnnipasnkyneggvlerckn
gwtqnflhnievilgypkk

SCOPe Domain Coordinates for d3ni8a1:

Click to download the PDB-style file with coordinates for d3ni8a1.
(The format of our PDB-style files is described here.)

Timeline for d3ni8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ni8a2