Lineage for d3nfua2 (3nfu A:133-441)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1823470Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 1823858Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 1823859Protein automated matches [226923] (71 species)
    not a true protein
  7. 1824017Species Chromohalobacter salexigens [TaxId:290398] [232967] (8 PDB entries)
  8. 1824045Domain d3nfua2: 3nfu A:133-441 [247902]
    Other proteins in same PDB: d3nfua1, d3nfub1
    automated match to d3mznb2
    complexed with gol, mg, so4

Details for d3nfua2

PDB Entry: 3nfu (more details), 1.94 Å

PDB Description: crystal structure of probable glucarate dehydratase from chromohalobacter salexigens dsm 3043 complexed with magnesium
PDB Compounds: (A:) glucarate dehydratase

SCOPe Domain Sequences for d3nfua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nfua2 c.1.11.0 (A:133-441) automated matches {Chromohalobacter salexigens [TaxId: 290398]}
qygrqrdevealgylfllgdpdktdlpyprvadpvdawdevryreamtpeavanlaraay
drygfkdfklkggvlrgeeeadciralheafpearlaldpngawkldeavrvlepikhll
syaedpcgqeggfsgretmaefkkrtglptatnmiatdykqlqyavqlnsvdipladchf
wtmqgavavgelcnewgmtwgshsnnhfdislammthvaaacpgeitaidthwiwqdgqr
itrepfqirdgkltvpktpglgieldddklmeahetykrldvtqrndamamqylipgwef
dpkrpalve

SCOPe Domain Coordinates for d3nfua2:

Click to download the PDB-style file with coordinates for d3nfua2.
(The format of our PDB-style files is described here.)

Timeline for d3nfua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3nfua1