Lineage for d3nfua1 (3nfu A:1-132)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1649013Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1649014Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1649263Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1649264Protein automated matches [226922] (67 species)
    not a true protein
  7. 1649398Species Chromohalobacter salexigens [TaxId:290398] [232962] (2 PDB entries)
  8. 1649401Domain d3nfua1: 3nfu A:1-132 [247901]
    Other proteins in same PDB: d3nfua2, d3nfub2
    automated match to d3mznb1
    complexed with gol, mg, so4

Details for d3nfua1

PDB Entry: 3nfu (more details), 1.94 Å

PDB Description: crystal structure of probable glucarate dehydratase from chromohalobacter salexigens dsm 3043 complexed with magnesium
PDB Compounds: (A:) glucarate dehydratase

SCOPe Domain Sequences for d3nfua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3nfua1 d.54.1.0 (A:1-132) automated matches {Chromohalobacter salexigens [TaxId: 290398]}
lfpkitkmnvvpvagedgfllnlsgghepwfircvlvledesgnrgvgeipssegilngl
ekcrslvegarvnevkqvlsrargllaqggpeergrqtfdlrvavhvitaiesalfdlfg
qalgmpvadllg

SCOPe Domain Coordinates for d3nfua1:

Click to download the PDB-style file with coordinates for d3nfua1.
(The format of our PDB-style files is described here.)

Timeline for d3nfua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3nfua2