SCOP 1.55: Domain d1g3p_1: 1g3p 1-65

Lineage for d1g3p_1 (1g3p 1-65)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.37: N-terminal domains of the minor coat protein g3p [50175] (1 superfamily)

4. Superfamily b.37.1: N-terminal domains of the minor coat protein g3p [50176] (1 family)

5. Family b.37.1.1: N-terminal domains of the minor coat protein g3p [50177] (1 protein)

6. Protein N-terminal domains of the minor coat protein g3p [50178] (2 species)

7. Species Bacteriophage M13 [TaxId:10870] [50179] (2 PDB entries)

8. Domain d1g3p_1: 1g3p 1-65 [24788]

Details for d1g3p_1

PDB Entry: 1g3p, 1.46 Å

PDB Description: crystal structure of the n-terminal domains of bacteriophage minor coat protein g3p

SCOP Domain Sequences for d1g3p_1:

Sequence; same for both SEQRES and ATOM records:

>d1g3p_1 b.37.1.1 (1-65) N-terminal domains of the minor coat protein g3p {Bacteriophage M13}
aetvesclakshtensftnvwkddktldryanyegclwnatgvvvctgdetqcygtwvpi
glaip

Timeline for d1g3p_1:

• d1g3p_1 appears in SCOP 1.57
  
• d1g3p_1 appears in the current release, SCOPe 2.08, called d1g3pa1